DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and Ets21C

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001285547.1 Gene:Ets21C / 33229 FlyBaseID:FBgn0005660 Length:475 Species:Drosophila melanogaster


Alignment Length:85 Identity:39/85 - (45%)
Similarity:52/85 - (61%) Gaps:2/85 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   784 GSTTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALR 848
            |....||:|||:||.|.... ..|.|.. :.|.|:|:|...|:|.||..|.||:|||:.:.||||
  Fly   252 GGQIQLWQFLLELLADSSNA-NAISWEG-QSGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALR 314

  Fly   849 YYYQRGILAKVDGQRLVYQF 868
            |||.:.|:.||.|:|..|:|
  Fly   315 YYYDKNIMTKVHGKRYAYKF 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 38/80 (48%)
Ets21CNP_001285547.1 SAM_PNT 149..217 CDD:188876
ETS 254..339 CDD:197710 38/83 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450429
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.