DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and ets2

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001018874.1 Gene:ets2 / 326672 ZFINID:ZDB-GENE-050522-552 Length:439 Species:Danio rerio


Alignment Length:242 Identity:74/242 - (30%)
Similarity:99/242 - (40%) Gaps:52/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   667 LNGPHPHSHPHSHPHSHPHAGQHTHSTIAAAAAAA--------AASVVS---------------- 707
            |..|:|||       |.......|....|..|:||        ..|.||                
Zfish   185 LTAPNPHS-------SLLRELFQTSDDAALLASAAELPACAKPQLSTVSVRYRSHEFTKNTPQLR 242

  Fly   708 -SSSSAVAAAAMLSASAAAAATAAAAAGGSQSVIQPATSSVSYDLSY---MLELG------GF-- 760
             :.||...|:   ..|..:|......:.||.|.:.......||| |:   :|.||      .|  
Zfish   243 TAGSSGEQAS---QESVESAEECVLRSWGSHSSLADTQRVPSYD-SFEEELLPLGLQKHGRSFKD 303

  Fly   761 ---QQRKAKKPRKPKLEMGVKRRSREGSTTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDS 822
               ::.:.::..:|.:...|...........||:|||:||.| ..|...|.||. :...|||.|.
Zfish   304 YVQERNQTQETGRPVIPAAVLAGFTGSGPIQLWQFLLELLTD-STCQSIISWTG-DGWEFKLTDP 366

  Fly   823 KAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFV 869
            ..|:|.||..||||.||||.:.|.|||||.:.|:.|..|:|.||:||
Zfish   367 DEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFV 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 40/79 (51%)
ets2NP_001018874.1 SAM_superfamily 76..164 CDD:301707
ETS 332..416 CDD:197710 42/84 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.