DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and Fli1

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:XP_038937318.1 Gene:Fli1 / 315532 RGDID:1309837 Length:471 Species:Rattus norvegicus


Alignment Length:123 Identity:50/123 - (40%)
Similarity:66/123 - (53%) Gaps:17/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   757 LGGFQQRKAKKPRKPK------LEMGVKRRSREGS-TTYLWEFLLKLLQD--REYCPRFIKW--T 810
            |||.|.......::|:      |.....|.:..|| ...||:|||:||.|  ...|   |.|  |
  Rat   263 LGGAQSMGKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASC---ITWEGT 324

  Fly   811 NREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQF 868
            |   |.||:.|...|:|.||..|:||:|||:.:.|||||||.:.|:.||.|:|..|:|
  Rat   325 N---GEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 41/84 (49%)
Fli1XP_038937318.1 SAM_PNT-FLI-1 133..223 CDD:188883
ETS 299..382 CDD:197710 41/87 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.