DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and Elk1

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001101529.1 Gene:Elk1 / 314436 RGDID:1598663 Length:427 Species:Rattus norvegicus


Alignment Length:85 Identity:45/85 - (52%)
Similarity:64/85 - (75%) Gaps:1/85 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   789 LWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQR 853
            ||:|||:||:::.. ...|.||:|:.|.|||||::.|:||||:.|||.:|||:.:.|||||||.:
  Rat     7 LWQFLLQLLREQGN-GHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDK 70

  Fly   854 GILAKVDGQRLVYQFVDVPK 873
            .|:.||.||:.||:||..|:
  Rat    71 NIIRKVSGQKFVYKFVSYPE 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 42/79 (53%)
Elk1NP_001101529.1 ETS 4..89 CDD:197710 44/82 (54%)
PHA03247 <100..427 CDD:223021
PHA03132 112..>246 CDD:222997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..146
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..202
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..252
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..350
Sufficient for interaction with MAD2L2. /evidence=ECO:0000250|UniProtKB:P19419 348..398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.