DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and Etv6

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:XP_038963620.1 Gene:Etv6 / 312777 RGDID:1559537 Length:464 Species:Rattus norvegicus


Alignment Length:368 Identity:89/368 - (24%)
Similarity:141/368 - (38%) Gaps:92/368 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 HTGTFLHPN----LYQNNAANSLRNIWNRSVGVPDNYYGSSGAGSGGTQPGGPGNPQTPGYLTTS 587
            |.|..:|..    |:||:..:   |...|:                         |:||.  .:.
  Rat   146 HPGNSIHTKPEVLLHQNHEED---NCVQRT-------------------------PRTPA--ESL 180

  Fly   588 YFNAPTAATAAASQRGTTINGYHSLHQQQQQQQQSQQSQQQQQLAHQQLSHQQQQALHQQLSHQQ 652
            :.|.||.......:...|.|...|...:||:..:|......::|:..:  ..|...|.|:.:||:
  Rat   181 HHNPPTIELLHRPRSPITTNHRPSPDPEQQRPLRSPLDNMIRRLSPAE--RAQGPRLQQENNHQE 243

  Fly   653 Q---QQQQQQQQH-PHSQLNGPHPHSHPHSH----------PHSHPHAGQHTHSTIAAAAAAAAA 703
            .   .....:..| |.|..:.|.| |.|...          |..||......||           
  Rat   244 SYPLSVSPMENNHCPPSSESNPKP-SSPWQESTRVIQLMPSPIMHPLILNPRHS----------- 296

  Fly   704 SVVSSSSSAVAAAAMLSASAAAAATAAAAAGGSQSVIQPATSSVSYDLSYMLELGGFQQRKAKKP 768
              |....|.::...|....                  :|...|...||:||..:    ......|
  Rat   297 --VDFKQSRISEDGMHREG------------------KPINLSHREDLAYMNHI----MVSVSPP 337

  Fly   769 RKPKLEMGVKRRSREGSTTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHK 833
            .:..:.:|     |......||:::.:||.|..| ..||:|.::|..:|::||...::||||.||
  Rat   338 EEHAMPIG-----RIADCRLLWDYVYQLLSDSRY-ENFIRWEDKESKIFRIVDPNGLARLWGNHK 396

  Fly   834 NKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFVDVPKDII 876
            |:.:|.||.|.||||:||:..|:.|..||||:::|:..|.:|:
  Rat   397 NRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIM 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 36/79 (46%)
Etv6XP_038963620.1 SAM_PNT-Tel_Yan 67..134 CDD:176085
ETS 350..436 CDD:197710 37/86 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.