DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and Elf3

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001019939.1 Gene:Elf3 / 304815 RGDID:1310687 Length:395 Species:Rattus norvegicus


Alignment Length:391 Identity:95/391 - (24%)
Similarity:143/391 - (36%) Gaps:132/391 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   586 TSYFNA------PTAATAAASQRGT-----TINGYH--------SLHQQQQQQQQSQQSQQQQQL 631
            ::||||      ||.|.|..:..||     |:|..|        .:..|.:.|:...:......|
  Rat    12 SNYFNAMYSSEDPTLAPAPLTTFGTEDFVLTLNNQHMSPEGPVGCVGPQTRSQRDRTEPPAVLHL 76

  Fly   632 AHQQ------------------LSHQQQQ-----------------------ALHQ------QLS 649
            |.:.                  :|:|.::                       ||.:      .|.
  Rat    77 AEKASWTGERPQFWSKTQVLDWISYQVEKNKYDASSIDFSRCDMDGATLCNCALEELRLVFGPLG 141

  Fly   650 HQQQQQQQQQQQHPHSQL--------------------NGPHPHSHPHSHP------HSHPHAGQ 688
            .|...|.:........:|                    :||.....|.:..      .:.|:.| 
  Rat   142 DQLHAQLRDLTSSSSDELSWIIELLEKDGMTFQEGLGDSGPFDQGSPFAQELLDDGRQASPYYG- 205

  Fly   689 HTHSTIAAAAAAAAASVVSSSSSAVAAAAMLSASAAAAATAAAAAGGSQSVIQPATSSVSYDL-- 751
               |:....|.:..:|..|:|.:....::..|.|           ||         |.|..||  
  Rat   206 ---SSYGPGAPSPGSSDFSTSGTDTPQSSHSSDS-----------GG---------SDVDLDLTD 247

  Fly   752 SYMLELGGFQQRKAKKPRKPKLEMGVKRR-------SREGST-------TYLWEFLLKLLQDREY 802
            |.:....||...|..:|:..|.:.|..|:       ..||..       |:||||:..:|...|.
  Rat   248 SKVFPRDGFPDYKKGEPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPEL 312

  Fly   803 CPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQ 867
            ....:||.||.:||||.:.|:||::|||..|...:|.||.:.||:||||:|.||.:|||:||||:
  Rat   313 NEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYK 377

  Fly   868 F 868
            |
  Rat   378 F 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 41/80 (51%)
Elf3NP_001019939.1 SAM_PNT-ESE-1-like 78..155 CDD:188880 7/76 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..275 22/98 (22%)
ETS 296..383 CDD:197710 42/83 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.