DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and Elk4

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:XP_008767689.1 Gene:Elk4 / 304786 RGDID:1310504 Length:437 Species:Rattus norvegicus


Alignment Length:95 Identity:47/95 - (49%)
Similarity:69/95 - (72%) Gaps:3/95 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   785 STTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRY 849
            |...||:|||:|||:.:. ...|.||: ..|.|||:.::.|:||||:.||||:|||:.:.|||||
  Rat    10 SAITLWQFLLQLLQEPQN-EHVICWTS-NNGEFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRY 72

  Fly   850 YYQRGILAKVDGQRLVYQFVDVPKDIIEID 879
            ||.:.|:.||:||:.||:||..| :|:::|
  Rat    73 YYVKNIIKKVNGQKFVYKFVSYP-EILKMD 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 41/79 (52%)
Elk4XP_008767689.1 ETS 24..95 CDD:197710 35/72 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.