DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and elf1

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_571234.2 Gene:elf1 / 30396 ZFINID:ZDB-GENE-980526-335 Length:639 Species:Danio rerio


Alignment Length:128 Identity:83/128 - (64%)
Similarity:100/128 - (78%) Gaps:9/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   761 QQRKAKKPR---------KPKLEMGVKRRSREGSTTYLWEFLLKLLQDREYCPRFIKWTNREKGV 816
            ::.|.:|||         .|.|.:..|.:..:|:|.|||||||.||||:..||::||||.||||:
Zfish   166 RKTKVRKPRPARPCSPITNPSLPLKKKSKEGKGNTIYLWEFLLALLQDKNTCPKYIKWTQREKGI 230

  Fly   817 FKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFVDVPKDIIEID 879
            ||||||||||:|||.||||||||||||||||||||||||||||:||||||||.::|.|::.||
Zfish   231 FKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPTDLVIID 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 68/79 (86%)
elf1NP_571234.2 Elf-1_N 2..107 CDD:289109
Ets 203..282 CDD:278602 67/78 (86%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4176
eggNOG 1 0.900 - - E1_KOG3804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24710
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.