DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and Elf4

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001178664.1 Gene:Elf4 / 302811 RGDID:1560743 Length:660 Species:Rattus norvegicus


Alignment Length:154 Identity:90/154 - (58%)
Similarity:105/154 - (68%) Gaps:18/154 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   744 TSSVSYDLSYMLELGGFQQ--RKAKKPRK----------------PKLEMGVKRRSREGSTTYLW 790
            ||.......|.||....::  ||..|.||                |.:.:..|.:..:|||.|||
  Rat   146 TSDAGDQKEYSLEEVSREENLRKIGKSRKRNRKTKNNRSTSPVTDPSVPIRKKSKDGKGSTIYLW 210

  Fly   791 EFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGI 855
            ||||.|||||..||::||||.||||:||||||||||:|||..|||||||||||||||||||||||
  Rat   211 EFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGI 275

  Fly   856 LAKVDGQRLVYQFVDVPKDIIEID 879
            ||||:||||||||.::|||::.||
  Rat   276 LAKVEGQRLVYQFKEMPKDLVVID 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 68/79 (86%)
Elf4NP_001178664.1 Elf-1_N 2..103 CDD:403506
Ets 208..288 CDD:395126 68/79 (86%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4132
eggNOG 1 0.900 - - E1_KOG3804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44884
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11849
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.