DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and Spdef

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001344657.1 Gene:Spdef / 30051 MGIID:1353422 Length:325 Species:Mus musculus


Alignment Length:90 Identity:47/90 - (52%)
Similarity:64/90 - (71%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   781 SREGSTTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGR 845
            |..|...:||:||.:||.......|||:|.|:|||:||:.||..|:||||:.||:|.|||:.:.|
Mouse   233 SCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGVRKNRPAMNYDKLSR 297

  Fly   846 ALRYYYQRGILAKVD-GQRLVYQFV 869
            ::|.||::||:.|.| .||||||||
Mouse   298 SIRQYYKKGIIRKPDISQRLVYQFV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 43/80 (54%)
SpdefNP_001344657.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..100
SAM_PNT-PDEF-like 124..204 CDD:188878
ETS 238..324 CDD:197710 45/85 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D388142at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.