DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and Ehf

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001099963.1 Gene:Ehf / 295965 RGDID:1310282 Length:300 Species:Rattus norvegicus


Alignment Length:103 Identity:45/103 - (43%)
Similarity:68/103 - (66%) Gaps:2/103 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   766 KKPRKPKLEMGVKRRSREGSTTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWG 830
            ||.:...::...|:.:..|  |:||||:..:|...:..|..|||.:|.:|:|:.:.|:||::|||
  Rat   188 KKEQDHPVKSHTKKHNPRG--THLWEFIRDILLSPDKNPGLIKWEDRSEGIFRFLKSEAVAQLWG 250

  Fly   831 MHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQF 868
            ..||...|.||.:.||:||||:|.||.:|||:||||:|
  Rat   251 KKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 40/80 (50%)
EhfNP_001099963.1 SAM_PNT-ESE-3-like 39..116 CDD:188882
ETS 206..293 CDD:197710 42/85 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.