DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and Fev

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_653354.2 Gene:Fev / 246271 RGDID:628860 Length:237 Species:Rattus norvegicus


Alignment Length:115 Identity:47/115 - (40%)
Similarity:64/115 - (55%) Gaps:15/115 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   758 GGFQQRKAKK--PRKPKLEMGVKRRSREGSTTYLWEFLLKLLQDREY--CPRFIKWTNREKGVFK 818
            |.|::.|:..  |..|.::.|       .....||:|||:||.||..  |   |.|.... |.||
  Rat    23 GLFKEGKSPSWGPLSPAVQKG-------SGQIQLWQFLLELLADRANAGC---IAWEGGH-GEFK 76

  Fly   819 LVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQF 868
            |.|...|:|.||..|:||:|||:.:.|||||||.:.|::||.|:|..|:|
  Rat    77 LTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRF 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 41/82 (50%)
FevNP_653354.2 ETS 46..131 CDD:197710 41/85 (48%)
May mediate active transcriptional repression. /evidence=ECO:0000250 129..237
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.