DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and FLI1

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_002008.2 Gene:FLI1 / 2313 HGNCID:3749 Length:452 Species:Homo sapiens


Alignment Length:123 Identity:50/123 - (40%)
Similarity:66/123 - (53%) Gaps:17/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   757 LGGFQQRKAKKPRKPK------LEMGVKRRSREGS-TTYLWEFLLKLLQD--REYCPRFIKW--T 810
            |||.|.......::|:      |.....|.:..|| ...||:|||:||.|  ...|   |.|  |
Human   244 LGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASC---ITWEGT 305

  Fly   811 NREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQF 868
            |   |.||:.|...|:|.||..|:||:|||:.:.|||||||.:.|:.||.|:|..|:|
Human   306 N---GEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 41/84 (49%)
FLI1NP_002008.2 SAM_PNT-FLI-1 114..204 CDD:188883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..271 6/26 (23%)
ETS 280..363 CDD:197710 41/87 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..452
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.