DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and ELF4

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001120669.1 Gene:ELF4 / 2000 HGNCID:3319 Length:663 Species:Homo sapiens


Alignment Length:221 Identity:99/221 - (44%)
Similarity:123/221 - (55%) Gaps:33/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   686 AGQHTHSTIAAAAAAAAASVVSSSSSAVAAAAMLSASAAAAATAAAAAGGSQSVIQPAT------ 744
            |..||.||........:.|.:.......:.:.||..|..|.|...      .:.:.||:      
Human    87 ATSHTMSTAEVLLNMESPSDILDEKQIFSTSEMLPDSDPAPAVTL------PNYLFPASEPDALN 145

  Fly   745 --SSVSYDLSYMLELGGFQQRKAKKPRK-------------------PKLEMGVKRRSREGSTTY 788
              ...|....:.||....::..|||..|                   |.:.:..|.:..:|||.|
Human   146 RAGDTSDQEGHSLEEKASREESAKKTGKSKKRIRKTKGNRSTSPVTDPSIPIRKKSKDGKGSTIY 210

  Fly   789 LWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQR 853
            ||||||.|||||..||::||||.||||:||||||||||:|||..|||||||||||||||||||||
Human   211 LWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQR 275

  Fly   854 GILAKVDGQRLVYQFVDVPKDIIEID 879
            ||||||:||||||||.::|||::.|:
Human   276 GILAKVEGQRLVYQFKEMPKDLVVIE 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 68/79 (86%)
ELF4NP_001120669.1 Elf-1_N 2..104 CDD:315071 5/16 (31%)
RUNX1-binding. /evidence=ECO:0000269|PubMed:10207087 87..206 22/124 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..203 9/62 (15%)
ETS 208..290 CDD:197710 69/81 (85%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..353 99/221 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 493..518
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 582..605
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 635..663
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4215
eggNOG 1 0.900 - - E1_KOG3804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40744
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.