DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and ELF1

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001357259.1 Gene:ELF1 / 1997 HGNCID:3316 Length:619 Species:Homo sapiens


Alignment Length:226 Identity:102/226 - (45%)
Similarity:123/226 - (54%) Gaps:46/226 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   685 HAGQHTHSTIAAAAAAAAA--------------SVVSSSSSAVAAAAMLSASAA----------- 724
            |.|..|..||.||.|....              ::.||....:..|.:...|..           
Human    90 HDGDETIETIEAAEALLNMDSPGPMLDEKRINNNIFSSPEDDMVVAPVTHVSVTLDGIPEVMETQ 154

  Fly   725 AAATAAAAAGGSQSVIQPATSSVSYDLSYMLELGGFQQRKAKKPR------KPKLEMGVKRRSRE 783
            ......|.:.|:.|..||...               :.||.|.||      .|.:.:..|.:..:
Human   155 QVQEKYADSPGASSPEQPKRK---------------KGRKTKPPRPDSPATTPNISVKKKNKDGK 204

  Fly   784 GSTTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALR 848
            |:|.|||||||.||||:..||::||||.||||:||||||||||||||.|||||||||||||||||
Human   205 GNTIYLWEFLLALLQDKATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALR 269

  Fly   849 YYYQRGILAKVDGQRLVYQFVDVPKDIIEID 879
            |||||||||||:||||||||.::|||:|.|:
Human   270 YYYQRGILAKVEGQRLVYQFKEMPKDLIYIN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 69/79 (87%)
ELF1NP_001357259.1 Elf-1_N 2..111 CDD:372034 8/20 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..199 11/55 (20%)
ETS 207..289 CDD:197710 70/81 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..366 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 564..592
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4215
eggNOG 1 0.900 - - E1_KOG3804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40744
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11849
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.