DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and ets-7

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_504947.2 Gene:ets-7 / 184687 WormBaseID:WBGene00017601 Length:218 Species:Caenorhabditis elegans


Alignment Length:98 Identity:37/98 - (37%)
Similarity:50/98 - (51%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   775 MGVKRRSREGSTTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMN 839
            |..||.|..|....| .||..||:|..:.. .|.|:|::...|:::....|:.|||.....|.||
 Worm     1 MSSKRTSPNGKQRLL-NFLRGLLEDDSHSD-LITWSNKDTLEFQMLKPHKVAELWGAATGNPGMN 63

  Fly   840 YETMGRALRYYYQRGILAKVDGQRLVYQFVDVP 872
            |:.|.|.|||:|....|.||.|:...|.|:|.|
 Worm    64 YDKMSRGLRYFYTNNTLKKVKGKDSRYCFLDTP 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 29/79 (37%)
ets-7NP_504947.2 Ets 14..93 CDD:365925 29/80 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.