DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and ets-8

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_500046.2 Gene:ets-8 / 183631 WormBaseID:WBGene00016798 Length:141 Species:Caenorhabditis elegans


Alignment Length:115 Identity:40/115 - (34%)
Similarity:61/115 - (53%) Gaps:10/115 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   755 LELGGFQQRKAKKPRKPKLEMGVKRRSREGSTTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKL 819
            ||.|..:.|..|.||.         .|.:....||::.:||...|:... :.||||.:....|::
 Worm     7 LEPGNQENRNPKNPRS---------TSHKKLRNYLFQMILKSENDKNVA-KIIKWTKKSSLEFQM 61

  Fly   820 VDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFV 869
            ||.:.|:||||..|....|:||.:.|::|.||:.||:.|:.|:...|||:
 Worm    62 VDRQEVARLWGAEKGNLKMDYEFLSRSIRSYYKSGIMRKIPGKDFRYQFI 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 30/79 (38%)
ets-8NP_500046.2 ETS 25..115 CDD:197710 32/88 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.