Sequence 1: | NP_001014590.1 | Gene: | Eip74EF / 39962 | FlyBaseID: | FBgn0000567 | Length: | 883 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001257261.1 | Gene: | svh-5 / 181627 | WormBaseID: | WBGene00006462 | Length: | 493 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 62/207 - (29%) |
---|---|---|---|
Similarity: | 99/207 - (47%) | Gaps: | 37/207 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 680 PHSHPHAGQHTHSTIAAAAAAAAASVVSSSSSAVAAAAMLSASAAAAATAAAAAGGSQSVIQPAT 744
Fly 745 S-SVSYDLSYMLELGGFQQRKAK------------KPRKPKLEMGVKRRSREGSTTYLWEFLLKL 796
Fly 797 LQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVD- 860
Fly 861 ----GQRLVYQF 868 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Eip74EF | NP_001014590.1 | Ets | 789..869 | CDD:278602 | 35/85 (41%) |
svh-5 | NP_001257261.1 | SAM_PNT_ESE | 135..203 | CDD:188885 | |
ETS | 393..485 | CDD:197710 | 35/88 (40%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |