powered by:
Protein Alignment Eip74EF and ets-9
DIOPT Version :9
Sequence 1: | NP_001014590.1 |
Gene: | Eip74EF / 39962 |
FlyBaseID: | FBgn0000567 |
Length: | 883 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001371009.1 |
Gene: | ets-9 / 180702 |
WormBaseID: | WBGene00016865 |
Length: | 225 |
Species: | Caenorhabditis elegans |
Alignment Length: | 64 |
Identity: | 22/64 - (34%) |
Similarity: | 38/64 - (59%) |
Gaps: | 5/64 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 792 FLLKLLQDREYCPRFIKWTNREKGV-FKLVDSKAVSRLWGMHK-NKPDMNYETMGRALRYYYQR 853
||:.|..: |...:.::||. .|: |.||:.:.|:::||..| |..||:|..:.||:|..|::
Worm 90 FLVHLAMN-ERARKALRWTG--NGLEFVLVNKELVAKMWGNRKHNTKDMDYYKLSRAIREKYEK 150
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Eip74EF | NP_001014590.1 |
Ets |
789..869 |
CDD:278602 |
22/64 (34%) |
ets-9 | NP_001371009.1 |
Ets |
86..>150 |
CDD:413392 |
22/62 (35%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.