DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and gabpa

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001116494.1 Gene:gabpa / 100126064 XenbaseID:XB-GENE-987250 Length:454 Species:Xenopus tropicalis


Alignment Length:145 Identity:55/145 - (37%)
Similarity:79/145 - (54%) Gaps:21/145 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   740 IQPATSSVSYDLSYMLELGGFQQRKAKKPRKPKLEMGVKRRSREGSTT------YLWEFLLKLLQ 798
            |||...:.       :::...|.:.||..|.|::  ..:.||..|:.|      .||:|||:||.
 Frog   277 IQPTAQTT-------IKVINSQTKVAKIQRTPRI--SGEDRSSPGNRTGNNGQIQLWQFLLELLT 332

  Fly   799 DREY--CPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDG 861
            |::.  |   |.|.. ::|.|||...:.|::.||..||||.||||.:.|||||||...::.||.|
 Frog   333 DKDARDC---ISWVG-DEGEFKLNQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQG 393

  Fly   862 QRLVYQFVDVPKDII 876
            :|.||:||...|.:|
 Frog   394 KRFVYKFVCDLKTLI 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 39/81 (48%)
gabpaNP_001116494.1 GABP-alpha 40..119 CDD:371630
SAM_PNT-GABP-alpha 168..254 CDD:176084
ETS 320..404 CDD:197710 41/87 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.