DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and CCNQ

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_689487.2 Gene:CCNQ / 92002 HGNCID:28434 Length:248 Species:Homo sapiens


Alignment Length:241 Identity:60/241 - (24%)
Similarity:109/241 - (45%) Gaps:34/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PSRRCGIKGD--DELQYRQMTAYLIQEMGQRLQVSQLCINTAIVYMHRFYAFHSFTHFHRNSMAS 118
            |:.| |.:|.  .|.:.....|..|.|.|.:|.:..:.|.||....|:|:...:...:....:|.
Human    11 PAAR-GPEGQPAPEARVHFRVARFIMEAGVKLGMRSIPIATACTIYHKFFCETNLDAYDPYLIAM 74

  Fly   119 ASLFLAAKVEEQPRKLEHVIRAANKCLPPTTE-----QNYAELAQELVFNENVLLQTLGFDVAID 178
            :|::||.|||||..:...:|..:|:...|:.|     ..:.||...:|..|.::|:.|.|.|:..
Human    75 SSIYLAGKVEEQHLRTRDIINVSNRYFNPSGEPLELDSRFWELRDSIVQCELLMLRVLRFQVSFQ 139

  Fly   179 HPHTHVV----------------RTCQLVKACKDLAQTSYFLASNSLHLTSMCLQYRPTVVACFC 227
            |||.:::                ||        .:|.|::.|..:|.| .::||:::...:|...
Human   140 HPHKYLLHYLVSLQNWLNRHSWQRT--------PVAVTAWALLRDSYH-GALCLRFQAQHIAVAV 195

  Fly   228 IYLACKWSRWEIPQSTEG-KHWFYYVDKTVSLDLLKQLTDEFIAIY 272
            :|||.:....|:|...|. |.|:...:..::..::..:..:.|.||
Human   196 LYLALQVYGVEVPAEVEAEKPWWQVFNDDLTKPIIDNIVSDLIQIY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 35/126 (28%)
CYCLIN <203..>251 CDD:214641 14/48 (29%)
CCNQNP_689487.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 4/10 (40%)
CYCLIN_CCNM_CCNQ_rpt1 26..135 CDD:410237 29/108 (27%)
CYCLIN_CCNM_CCNQ_rpt2 140..243 CDD:410238 24/111 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.