DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and CCNH

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:XP_005248684.1 Gene:CCNH / 902 HGNCID:1594 Length:329 Species:Homo sapiens


Alignment Length:348 Identity:72/348 - (20%)
Similarity:127/348 - (36%) Gaps:105/348 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 WYFSN-DQLAN-----SPSRRCGIKGDDEL---------QYRQMTAYLIQEMGQRLQVSQLC--- 91
            |.||: :|||.     :...||....:.::         .:.:||  |.:...:||  .:.|   
Human    11 WTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMT--LCKYYEKRL--LEFCSVF 71

  Fly    92 --------INTAIVYMHRFYAFHSFTHFHRNSMASASLFLAAKVEE----QPRKLEHVIRAANKC 144
                    :.||.:|..|||..:|...:|...:.....|||.||:|    .|:.:.::..:    
Human    72 KPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRES---- 132

  Fly   145 LPPTTEQNYAELAQELVFNENVLLQTLGFDVAIDHPHT-------------HVVRTCQLVKACKD 196
              |..::...|   :::..|.:|:|.|.|.:.:.:|:.             .::...::::...|
Human   133 --PLGQEKALE---QILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTAD 192

  Fly   197 LAQTSYFLASNSLHLTSMCLQYRPTVVACFCIYLACKWSRWEIPQSTEGKHWFYYVDKTVSL--- 258
                 .||  |.:.||...|.|.|:.:|...|..:.  ||..|...:       |:.:::.|   
Human   193 -----DFL--NRIALTDAYLLYTPSQIALTAILSSA--SRAGITMES-------YLSESLMLKEN 241

  Fly   259 -DLLKQLTDEFIAIYEKSPARLKSKLNSIKAIAQGASNRTANSKDKPKEDWK-------ITEMMK 315
             ..|.||.|           .:||..|.:|......|...|..|.|.:....       ||:..|
Human   242 RTCLSQLLD-----------IMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRK 295

  Fly   316 GY-----------HSNITTPPEL 327
            ||           |..:...|::
Human   296 GYEDDDYVSKKSKHEEVCFTPKM 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 36/160 (23%)
CYCLIN <203..>251 CDD:214641 13/47 (28%)
CCNHXP_005248684.1 ccl1 2..308 CDD:129660 70/336 (21%)
CYCLIN 62..152 CDD:214641 22/100 (22%)
Cyclin_C_2 162..262 CDD:293504 25/126 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149869
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.