DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and SSN8

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_014373.3 Gene:SSN8 / 855706 SGDID:S000004970 Length:323 Species:Saccharomyces cerevisiae


Alignment Length:224 Identity:49/224 - (21%)
Similarity:86/224 - (38%) Gaps:56/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SGIPITANNNLPFEKDKIWYFSNDQLANSPSRRCGIKGDDELQYRQMTAYLIQEMGQRLQVSQLC 91
            :||..:...|:|.....:.|                  |.:...|....:||.::|:||.:.|..
Yeast    49 NGIEQSITKNIPITHRDLHY------------------DKDYNLRIYCYFLIMKLGRRLNIRQYA 95

  Fly    92 INTAIVYMHRFYAFHSFTHFHRNSMASASLFLAAKVEEQPRKLEHVIRAANKCLP------PTTE 150
            :.||.:|:.||....|....:...:.:..::||.||||.|:.:..::..|....|      ||..
Yeast    96 LATAHIYLSRFLIKASVREINLYMLVTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKV 160

  Fly   151 QNYAELAQELVFNENVLLQTLGFDVAIDHPHTHVVRTCQLVKA--------------CKDLAQTS 201
            ..:          |..||:.|...:.:.||:..:.:..|::|.              |..|...|
Yeast   161 TEF----------EFYLLEELESYLIVHHPYQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDS 215

  Fly   202 YFLASNSLHLTSMCLQYRPTVVACFCIYL 230
            |.   |.:||.     |.|.::|..|:::
Yeast   216 YI---NDVHLL-----YPPHIIAVACLFI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 30/139 (22%)
CYCLIN <203..>251 CDD:214641 7/28 (25%)
SSN8NP_014373.3 CCL1 27..323 CDD:227640 49/224 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.