DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and CTK2

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_012528.1 Gene:CTK2 / 853450 SGDID:S000003543 Length:323 Species:Saccharomyces cerevisiae


Alignment Length:391 Identity:64/391 - (16%)
Similarity:136/391 - (34%) Gaps:97/391 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IPITANNNLPFEKDKIWYFSNDQLANSPSRRCGIKGDDELQYRQMTAYL---IQEMGQRLQVSQL 90
            :|.|..:.|.|.:.   :.|..|:..:.....    .|...|.|....:   :.::..:|:..:.
Yeast     1 MPSTFESQLFFSRP---FLSKRQIQRAQKNTI----SDYRNYNQKKLAVFKFLSDLCVQLKFPRK 58

  Fly    91 CINTAIVYMHRFYAFHSFTHFHRNSMASASLFLAAKVEEQPRKLEHVIRAANKCLPPTTEQNYAE 155
            .:.||:.:..|::.|:.|......::|::.|.|..|..|..:|...:      |......:|..:
Yeast    59 TLETAVYFYQRYHLFNRFETEVCYTVATSCLTLGCKEVETIKKTNDI------CTLSLRLRNVVK 117

  Fly   156 LAQELVFN--------ENVLLQTLGFDVAID---HPHTHVVRTCQLVKACKDLAQTSYFLASNSL 209
            :..:::.|        |..:|::..||..::   |...:|::..:.:.....|...::.:|.::|
Yeast   118 INTDILENFKKRVFQIELRILESCSFDYRVNNYVHIDEYVIKIGRELSFDYKLCNLAWVIAYDAL 182

  Fly   210 HL-TSMCLQYRPTVVACFCI---------YLACKWSRWEIPQSTEGKHWF----YYVDKTVSLDL 260
            .| |.:.:......:|...|         :.:.::|.:|..:.:..:.:|    :|::.....||
Yeast   183 KLETILVIPQHSIALAILKIAYELLDNKNWSSKRYSLFETDEKSVNEAYFDIVNFYINSFDMCDL 247

  Fly   261 LKQLTDEFIAIYEKSPARLKSKLNSIKAIAQGASNRTANSKDKPKEDWKITEMMKGYHSNITTPP 325
            .:.|..:.:.|..:....||........:.|                               .|.
Yeast   248 QRHLPADLLPIGVERFMELKKNAGPESGLPQ-------------------------------IPD 281

  Fly   326 ELLNGNDSRDRDRDRERERERERDPSSLLPPPAMVPQQRRQDGGHQRSSSVSGVPGSSSSSSSSS 390
            .|||.:......||..                   .|:||.      ..|:..:.|.||.:||:.
Yeast   282 HLLNADPYITITRDNN-------------------VQERRY------VLSLELINGESSINSSTR 321

  Fly   391 H 391
            |
Yeast   322 H 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 24/144 (17%)
CYCLIN <203..>251 CDD:214641 9/61 (15%)
CTK2NP_012528.1 CCL1 1..299 CDD:227640 54/360 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10026
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.