DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and Ccnh

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_443213.3 Gene:Ccnh / 84389 RGDID:69419 Length:323 Species:Rattus norvegicus


Alignment Length:327 Identity:70/327 - (21%)
Similarity:125/327 - (38%) Gaps:86/327 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 WYF-SNDQLAN---SPSRRCGIKG--------DDEL---QYRQMTAYLIQEMGQRLQVSQLC--- 91
            |.| |.:|||.   ..:|:...|.        :|.|   .:.:||  |.:...:||  .:.|   
  Rat    11 WTFASEEQLARLRADANRKFKCKAVANGKVLPNDPLFLEPHEEMT--LCKYYEKRL--LEFCSVF 71

  Fly    92 --------INTAIVYMHRFYAFHSFTHFHRNSMASASLFLAAKVEE----QPRKLEHVIRAANKC 144
                    :.||.:|..|||..:|...:|...:.....|||.||:|    .|:.:.::..:    
  Rat    72 KPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRES---- 132

  Fly   145 LPPTTEQNYAELAQELVFNENVLLQTLGFDVAIDHPHTHVVRTCQLVKACKDLAQTSYFLASNS- 208
              |..::...|   :::..|.:|:|.|.|.:.:.:|:.........:|....:.:....|...: 
  Rat   133 --PLGQEKALE---QILEYELLLIQQLNFHLIVHNPYRPFEGFLIDIKTRYPMLENPEILRKTAD 192

  Fly   209 -----LHLTSMCLQYRPTVVACFCIYLACKWSRWEIPQSTEGKHWFYYVDKTVS----------- 257
                 :.||...|.|.|:.:|...|..:.  ||..|...:       |:.:::.           
  Rat   193 DFLSRIALTDAYLLYTPSQIALTAILSSA--SRAGITMES-------YLSESLMLKENRTCLSQL 248

  Fly   258 LDLLKQLTD----------EFIAIYEKSPARLKSK---LNSIKAIAQGASNRTANSKDKPK---E 306
            ||::|.:.:          |.:||.::...|..|.   ||.:....:|..:....|| |||   |
  Rat   249 LDIMKSMRNLVKKYEPPRSEEVAILKQKLERCHSSDLALNMVTKKRKGYEDDDYVSK-KPKQEEE 312

  Fly   307 DW 308
            :|
  Rat   313 EW 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 38/160 (24%)
CYCLIN <203..>251 CDD:214641 11/53 (21%)
CcnhNP_443213.3 ccl1 2..308 CDD:129660 66/319 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..323 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343758
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.