DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and CYCT1;1

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_174775.1 Gene:CYCT1;1 / 840436 AraportID:AT1G35440 Length:247 Species:Arabidopsis thaliana


Alignment Length:237 Identity:70/237 - (29%)
Similarity:115/237 - (48%) Gaps:12/237 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KIWYFSNDQL-ANSPSRRCGIKGDDELQYRQMTAYLIQEMGQRLQVSQLCINTAIVYMHRFYAFH 106
            |.||.:.:.: ..||||..||...:|...|......:||:||||...|..|.||||...||:...
plant     5 KNWYNTREAIEKTSPSRLDGINLKEETFQRWSYTSFLQELGQRLNNPQKTIATAIVLCQRFFTRQ 69

  Fly   107 SFTHFHRNSMASASLFLAAKVEEQPRKLEHVIRAANKCL---PPTTEQNYAELAQELVFNENVLL 168
            |.|.....::|...:|:|.|||..||....|:..:.:.|   .|..:. :..|...::..|.::|
plant    70 SLTKNDPKTVAIICMFIAGKVEGSPRPAGDVVFVSYRVLFNKEPLRDV-FERLKMTVLTGEKLVL 133

  Fly   169 QTLGFDVAIDHPHTHV---VRTCQLVKACKDLAQTSYFLASNSLHLTSMCLQYRPTVVACFCIYL 230
            .||..|:.|:||:..|   |:.....:..:.|.|.::...::||. ||:|||:.|:.:|...||:
plant   134 STLECDLEIEHPYKLVMDWVKRSVKTEDGRRLCQAAFNFVNDSLR-TSLCLQFGPSQIASAAIYI 197

  Fly   231 ACKWSRWEIPQSTEGKHWFYYVDKTVSLDLLKQLTDEFIAIY 272
            .....:..:|...: |.|:...|  |:...|.::.|:.:.:|
plant   198 GLSMCKMTLPCDGD-KAWWREFD--VTKRQLWEICDQMLDLY 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 44/136 (32%)
CYCLIN <203..>251 CDD:214641 14/47 (30%)
CYCT1;1NP_174775.1 CCL1 13..>213 CDD:227640 60/202 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 80 1.000 Domainoid score I2988
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10026
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.