DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and CYCT1;4

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_193695.2 Gene:CYCT1;4 / 827702 AraportID:AT4G19600 Length:541 Species:Arabidopsis thaliana


Alignment Length:419 Identity:117/419 - (27%)
Similarity:199/419 - (47%) Gaps:76/419 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SGIPITANNNLPFEKDKI--WYFSNDQL-ANSPSRRCGIKGDDELQYRQMTAYLIQEMGQRLQVS 88
            ||:...:.|:.. ::|::  |||...:: .|||||...|....|...|:.....:|::|.||:|.
plant    14 SGVSSYSRNSNE-KQDEVARWYFGRKEIEENSPSRLDSIDLKKETYLRKSYCTFLQDLGMRLKVP 77

  Fly    89 QLCINTAIVYMHRFYAFHSFTHFHRNSMASASLFLAAKVEEQPRKLEHVIRAANKCL---PPTTE 150
            |:.|.|||::.|||:...|.....|.::|:..:|||.||||.||.|:.||..:.:.:   .|||.
plant    78 QVTIATAIIFCHRFFIRQSHARNDRRTIATVCMFLAGKVEETPRPLKDVIVVSYEIIHKKDPTTA 142

  Fly   151 QNYA-----ELAQELVFN-ENVLLQTLGFDVAIDHPHTHVVRTCQLVKACKD-LAQTSYFLASNS 208
            |...     |..:||:.| |.::|.|||||..:.||:..:|...:..|..:: |||.::...::.
plant   143 QKIKQKEVYEQQKELILNGEKIVLSTLGFDFNVYHPYKPLVEAIKKFKVAQNALAQVAWNFVNDG 207

  Fly   209 LHLTSMCLQYRPTVVACFCIYLACKWSRWEIPQSTEGKHWFYYVDKTVSLDLLKQLTDEFIAIYE 273
            |. ||:|||::|..:|...|:||.|:.:.::|...| |.|:...|  |:...|:.::::.:.:||
plant   208 LR-TSLCLQFKPHHIAAGAIFLAAKFLKVKLPSDGE-KVWWQEFD--VTPRQLEDVSNQMLELYE 268

  Fly   274 KS--PARLKSKLNSIKAIAQGASNRTANSKDKPKEDWKITEMMKGYHSNITTPPELLNGNDSRDR 336
            ::  ||   |:::.:::...|.|.....|:...:        :...|||    .:.|.|:....:
plant   269 QNRVPA---SQVSEVESSVGGGSAHHVGSRPSAR--------LTHEHSN----SDNLGGSTKATQ 318

  Fly   337 DRDRER----------ERERERDPSSLLPPPAMVPQQRRQDGGHQRS----SSVSGV--PGSSSS 385
            :|..:.          |::.|||..:             :|..|..|    .|.|||  ||....
plant   319 NRSNDNGSGEAGSVITEQKGERDTET-------------KDSMHTESHPAHKSRSGVEAPGEDKI 370

  Fly   386 SSSSSHKMPNYPGGMPPDAHTDHKSKQPG 414
            ..:.:|    :|        .|.||:..|
plant   371 EKAGAH----FP--------EDDKSRIVG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 55/145 (38%)
CYCLIN <203..>251 CDD:214641 16/47 (34%)
CYCT1;4NP_193695.2 CCL1 38..>244 CDD:227640 72/207 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 80 1.000 Domainoid score I2988
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10026
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.