DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and CYCT1;2

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_193691.2 Gene:CYCT1;2 / 827698 AraportID:AT4G19560 Length:460 Species:Arabidopsis thaliana


Alignment Length:328 Identity:98/328 - (29%)
Similarity:157/328 - (47%) Gaps:55/328 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MPQAATASSSSSASAAASASGIPITANNNLPFEKDKIWYFSNDQL-ANSPSRRCGIKGDDELQYR 71
            |.:|...::|.|.|.|:|.:       :||..::...|:||.::: .||||||.||....|.:.|
plant     1 MDEALNENASGSESDASSVA-------SNLHDDEIIPWFFSREEIERNSPSRRDGIDLKTETRLR 58

  Fly    72 QMTAYLIQEMGQRLQVSQLCINTAIVYMHRFYAFHSFTHFHRNSMASASLFLAAKVEEQPRKLEH 136
            ......::.:|:||:|.|:.|.|||.:.|||:...|.....|.::|:..:.||.||||.|..||.
plant    59 DSYCTFLEILGERLKVPQVTIATAIFFCHRFFLRQSHAKNDRQTIATVCMLLAGKVEETPVTLED 123

  Fly   137 VI-----RAANKCLPPTTEQNYAELAQELV-FNENVLLQTLGFDVAIDHPHTHVVRTCQ--LVKA 193
            ||     |...|.|.....:...:..:||| ..|.::|.||.||:.|.||:..:|...:  :|:.
plant   124 VIIASYERIHKKDLAGAQRKEVYDQQKELVLIGEELVLSTLNFDLCISHPYKPLVEAIKKYMVED 188

  Fly   194 CK-DLAQTSYFLASNSLHLTSMCLQYRPTVVACFCIYLACKWSRWEIPQSTEGKHWFYYVDKTVS 257
            .| .|||.::...::.|. |::||||:|..:|...|.||.     |:|              ||.
plant   189 AKTQLAQFAWNFVNDCLR-TTLCLQYQPHHIAAGAILLAA-----ELP--------------TVD 233

  Fly   258 L-----------DL----LKQLTDEFIAIYEKSPARLKSKLNS---IKAIAQGASNRTANSKDKP 304
            |           |:    |:.:..:.:.:||:.|...:||:.|   :..:.|..|...|:::..|
plant   234 LQSYREVLCQEFDITPCQLEDIRGQILELYERIPTSQESKVESSGGVAVVHQPISRDMASTEKCP 298

  Fly   305 KED 307
            ..|
plant   299 SSD 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 51/140 (36%)
CYCLIN <203..>251 CDD:214641 13/47 (28%)
CYCT1;2NP_193691.2 Cyclin_N 29..169 CDD:278560 51/139 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 80 1.000 Domainoid score I2988
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10026
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.