DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and Ccnh

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_075732.1 Gene:Ccnh / 66671 MGIID:1913921 Length:323 Species:Mus musculus


Alignment Length:269 Identity:55/269 - (20%)
Similarity:95/269 - (35%) Gaps:86/269 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 INTAIVYMHRFYAFHSFTHFHRNSMASASLFLAAKVEE------------------QPRKLEHVI 138
            :.||.:|..|||..:|...:|...:.....|||.||:|                  |.|.||.::
Mouse    80 VGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQERALEQIL 144

  Fly   139 RAANKCLPPTTEQNYAELAQELVFNENVLLQTLGFDVAIDHPHTHVVRTCQLVKACKDLAQTSYF 203
            .                       .|.:|:|.|.|.:.:.:|:.........:|....:.:....
Mouse   145 E-----------------------YELLLIQQLNFHLIVHNPYRPFEGFLIDIKTRYPMLENPEI 186

  Fly   204 LASNS------LHLTSMCLQYRPTVVACFCIYLACKWSRWEIPQSTEGKHWFYYVDKTVS----- 257
            |...:      :.||...|.|.|:.:|...|..:.  ||..|...:       |:.:::.     
Mouse   187 LRKTADDFLSRIALTDAYLLYTPSQIALTAILSSA--SRAGITMES-------YLSESLMLKENR 242

  Fly   258 ------LDLLKQL-----------TDEFIAIYEKSPARLKSK---LNSIKAIAQGASNRTANSKD 302
                  ||::|.:           :|| :|:.::...|..|.   ||::....:|..:....|| 
Mouse   243 TCLSQLLDIMKSMRNLVKKYEPPRSDE-VAVLKQKLERCHSSDLALNAVTKKRKGYEDDDYVSK- 305

  Fly   303 KPK---EDW 308
            |||   |:|
Mouse   306 KPKQEEEEW 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 23/101 (23%)
CYCLIN <203..>251 CDD:214641 11/53 (21%)
CcnhNP_075732.1 ccl1 2..308 CDD:129660 51/261 (20%)
CYCLIN 62..152 CDD:214641 20/94 (21%)
Cyclin_C_2 162..262 CDD:293504 17/108 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..323 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839914
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.