DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and ccnq

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:XP_009295009.1 Gene:ccnq / 553650 ZFINID:ZDB-GENE-050522-495 Length:254 Species:Danio rerio


Alignment Length:236 Identity:53/236 - (22%)
Similarity:111/236 - (47%) Gaps:26/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GIKGDDELQYRQ---MTAYLIQEMG-------QRLQVSQLCINTAIVYMHRFYAFHSFTHFHRNS 115
            |.:..::::|.:   .....|.|.|       .:|.:..:.:.||.|..|||:...|...:....
Zfish    16 GRRSAEDVEYSKTHFRVCRFITETGICIFMKWVKLGMRSVPMATACVLYHRFFQSASLQIYEPYL 80

  Fly   116 MASASLFLAAKVEEQPRKLEHVIRAANKCLPPTTEQ-----NYAELAQELVFNENVLLQTLGFDV 175
            :|.::::||.|||||..:...:|...::...|.:|.     .:.||...:|..|.::|:.|.|.|
Zfish    81 VAMSAIYLAGKVEEQHLRTRDIINVCHRYFHPDSEPLELNGKFWELRDSIVQCELLILRQLNFQV 145

  Fly   176 AIDHPHTHVVRTCQLVKACKD--------LAQTSYFLASNSLHLTSMCLQYRPTVVACFCIYLAC 232
            ..:|||.:::.....|::..:        :|:|:..:..:|.| .|:|:::||..:|...:|||.
Zfish   146 TFEHPHKYLLHYLLSVRSLLNRHAWSRTPIAETALAVLKDSYH-GSVCVRHRPQHLALTALYLAL 209

  Fly   233 KWSRWEIPQSTEGKHWFYYVDKTVSLDLLKQLTDEFIAIYE 273
            :....::|:..  ..|:..|...::...::.:..|.:.:|:
Zfish   210 QTYGVQLPRGE--LEWWQVVCADITKAQIETIMSELLQLYD 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 31/129 (24%)
CYCLIN <203..>251 CDD:214641 12/47 (26%)
ccnqXP_009295009.1 CYCLIN 49..138 CDD:238003 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.