DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and ccnh

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_001016256.1 Gene:ccnh / 549010 XenbaseID:XB-GENE-922561 Length:323 Species:Xenopus tropicalis


Alignment Length:338 Identity:69/338 - (20%)
Similarity:125/338 - (36%) Gaps:104/338 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KIWYFSNDQLANSPSRRCGIKGDDELQYRQMTAYLIQEMGQRLQVSQL----------------- 90
            |.|.|.||   :.|.|   ::.....:||...     :..::.:||::                 
 Frog     9 KHWTFLND---DEPQR---LRAQANARYRAKI-----QAAEKARVSEIFNLETHEELVICKYYEK 62

  Fly    91 -----C-----------INTAIVYMHRFYAFHSFTHFHRNSMASASLFLAAKVEEQPRKLEHVIR 139
                 |           :.||.:|:.|||..:|....|...:....:|||.||:|  ..:..|..
 Frog    63 RLLDFCNAFKPTMPKSVLGTACMYLKRFYLNNSVMEHHPRIIMLTCVFLACKVDE--FNVSSVQF 125

  Fly   140 AANKCLPPTTEQNYAELAQELVFNENVLLQTLGFDVAIDHPHT-------------HVVRTCQLV 191
            ..|....|..::   ::.::::..|.:|:|.|.|.:.:.:|:.             .::...:::
 Frog   126 VGNLGENPLGQE---KILEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPMLENPEML 187

  Fly   192 KACKDLAQTSYFLASNSLHLTSMCLQYRPTVVACFCIYLACKWSRWEIPQSTEGKHWFYYVDKTV 256
            :...|     .||  |.:.||..||.:.|:|:|...|....         |..|.:...|:.:.:
 Frog   188 RKSAD-----EFL--NRVALTDACLLFAPSVIALTAILSTA---------SRAGLNMESYLTECL 236

  Fly   257 SL----DLLKQLTDEF----IAIYEKSPAR------LKSKLNSIKA----IAQGASNRTANSKD- 302
            ||    :.:..|.|..    |.:.:..|||      ||.:|.:..:    ::..|..|.....| 
 Frog   237 SLKENQETMSHLYDGMRRLKILVSKYEPARSDEVAVLKKRLENCHSTEVTLSINARKRKGYEDDG 301

  Fly   303 ----KPK---EDW 308
                |||   |:|
 Frog   302 YISKKPKTEEEEW 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 34/165 (21%)
CYCLIN <203..>251 CDD:214641 13/47 (28%)
ccnhNP_001016256.1 ccl1 2..308 CDD:129660 65/330 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.