DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and CycC

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster


Alignment Length:249 Identity:68/249 - (27%)
Similarity:119/249 - (47%) Gaps:34/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 WYFSNDQ--LANSP----SRRCGIKGDDELQYRQM---TAYLIQEMGQRLQVSQLCINTAIVYMH 100
            |..|:.|  :.:.|    .|:..:...:|.:|:::   .|.:||.:|::|::.|..|.||.||..
  Fly     6 WQSSHSQQWILDKPDLLRERQHDLLALNEDEYQKVFIFFANVIQVLGEQLKLRQQVIATATVYFK 70

  Fly   101 RFYAFHSFTHFHRNSMASASLFLAAKVEE----QPRKLEHVIRAANKCLPPTTEQNYAELAQELV 161
            ||||.:|..:.....:|...:.||:||||    ...:|..:.::|.|     |:.:|| .|||..
  Fly    71 RFYARNSLKNIDPLLLAPTCILLASKVEEFGVISNSRLISICQSAIK-----TKFSYA-YAQEFP 129

  Fly   162 FNEN-------VLLQTLGFDVAIDHPHTHVVRTCQLVKACKDLAQTSYFLASNSLHLTSMCLQYR 219
            :..|       .||:.|...:.:..|:..:::..|.:.....|...|:.:.::||. |.:||.|.
  Fly   130 YRTNHILECEFYLLENLDCCLIVYQPYRPLLQLVQDMGQEDQLLTLSWRIVNDSLR-TDVCLLYP 193

  Fly   220 PTVVACFCIYLACKWSRWEIPQSTEGKHWFYYVDKTVSLDLLKQLTDEFIAIYE 273
            |..:|..|:.:||     .|.|....|.||  .:..|.||.::::....:.:||
  Fly   194 PYQIAIACLQIAC-----VILQKDATKQWF--AELNVDLDKVQEIVRAIVNLYE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 43/150 (29%)
CYCLIN <203..>251 CDD:214641 16/47 (34%)
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 35/111 (32%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 25/95 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453861
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10026
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.