DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and CycH

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster


Alignment Length:330 Identity:63/330 - (19%)
Similarity:112/330 - (33%) Gaps:102/330 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 WYFSND-QLAN---SPSRRCGIKGDDELQYRQMTAYLIQEMGQRLQVSQ-------LC------- 91
            |.|:|: ||..   ..:.:.....::|.|.|.:..:.:....:||.:.|       .|       
  Fly    11 WTFANEGQLMEFRVEQNSKYIESHEEEAQGRDLNEHFLTSAEERLLLKQYEIYLFDFCRRFEPTM 75

  Fly    92 ----INTAIVYMHRFYAFHSFTHFHRNSMASASLFLAAKVEEQPRKLEHVIR----AANKCLPPT 148
                :.||..|..|||..:|...:|...:.:..:|:|.||||....:...:.    ..||     
  Fly    76 PKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFVNNIKGDRNK----- 135

  Fly   149 TEQNYAELAQELVF-NENVLLQTLGFDVAIDHPHTHVVRTCQLVKACKDL-------AQTSYFLA 205
                    |.::|. ||.:|:..|.:.:.|.:|...:......:|...::       .....|: 
  Fly   136 --------ATDIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNPDRLRPHIDSFI- 191

  Fly   206 SNSLHLTSMCLQYRPTVVACFCIYLACKWSRWEIPQSTEGKHWFYYVDKTVSLDLLKQLTDEFIA 270
             :|.:.:..||.:.|:.:|...:..|.         |.|.::...||     .|||      |::
  Fly   192 -DSTYYSDACLLHTPSQIALAAVLHAA---------SREQENLDSYV-----TDLL------FVS 235

  Fly   271 IYEKSPARL-----------------KSKLNSIKAIAQGASNRTAN----------------SKD 302
            ..||.|..:                 :.|:.:|:.......|:..|                ..|
  Fly   236 AREKLPGLIDAVRKIRIMVKQYQQPDREKVKAIEKKLDKCRNQANNPDSELYKERLRRLYTDEDD 300

  Fly   303 KPKED 307
            .|.||
  Fly   301 MPAED 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 34/157 (22%)
CYCLIN <203..>251 CDD:214641 9/47 (19%)
CycHNP_524207.1 ccl1 2..307 CDD:129660 63/330 (19%)
CYCLIN 63..>127 CDD:238003 15/63 (24%)
Cyclin_C_2 159..257 CDD:293504 20/119 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453868
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10026
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.