DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and ccnc

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_956245.1 Gene:ccnc / 335429 ZFINID:ZDB-GENE-030131-7369 Length:283 Species:Danio rerio


Alignment Length:283 Identity:70/283 - (24%)
Similarity:123/283 - (43%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 WYFSNDQLANSPSRRCGIKGDDELQYRQMT---AYLIQEMGQRLQVSQLCINTAIVYMHRFYAFH 106
            |......|..  .|:..:|...|.:|.::.   |.:||.:|:.|::.|..|.||.||..||||.:
Zfish    14 WVLDKQDLMK--ERQKDLKFLTEEEYWKLQIFFANVIQALGEHLKLRQQVIATATVYFKRFYARY 76

  Fly   107 SFTHFHRNSMASASLFLAAKVEE-----QPRKLEHVIRAANKCLPPTTEQNYAELAQELVFNEN- 165
            |........||...:|||:||||     ..|    :|.||...|  .|..:|| ..:|..|..| 
Zfish    77 SLKSIDPVLMAPTCVFLASKVEEFGVVSNTR----LISAATSVL--KTRFSYA-FPKEFPFRMNH 134

  Fly   166 ------VLLQTLGFDVAIDHPHTHVVRTCQLVKACKDLAQTSYFL-----ASNSLHLTSMCLQYR 219
                  .||:.:...:.:.||:.      .|::..:|:.|....|     ..|..:.|.:||.|.
Zfish   135 ILECEFYLLELMDCCLIVYHPYR------PLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYP 193

  Fly   220 PTVVACFCIYLACKWSRWEIPQSTEGKHWFYYVDKTVSLDLLKQLTDEFIAIYE--------KSP 276
            |.::|..|:::||      :.|..:.:.||  .:.:|.::.:.::....:.:|:        |..
Zfish   194 PFMIALACLHVAC------VVQQKDARQWF--AELSVDMEKILEIIRVILKLYDQWKNFDDRKEI 250

  Fly   277 ARLKSKLNSIKAIAQGASNRTAN 299
            |.:.:|:...|......:::::|
Zfish   251 AAVLNKVPKPKPPPNSETDQSSN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 44/145 (30%)
CYCLIN <203..>251 CDD:214641 14/52 (27%)
ccncNP_956245.1 CYCLIN 48..>99 CDD:238003 22/50 (44%)
Cyclin_C_2 154..241 CDD:293504 21/100 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.