DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and ccnk-1

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_506615.2 Gene:ccnk-1 / 185704 WormBaseID:WBGene00009650 Length:252 Species:Caenorhabditis elegans


Alignment Length:266 Identity:76/266 - (28%)
Similarity:121/266 - (45%) Gaps:43/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 WYFSNDQLANSPSRRCGIKGDDELQYRQMTAYLIQEMGQRLQVS-QLCINTAIVYMHRFYAFHSF 108
            |.:..:.|..:||.|.|:..:.||.:|:....|:.|:|..|... :..|..|.||.||||..|||
 Worm     4 WIWPLEALKTTPSIRAGLTKEQELLWRREGIKLLSEVGNALNCKPRPTIGVAAVYFHRFYMIHSF 68

  Fly   109 THFHRNSMASASLFLAAKVEEQPRKLEHVIRAANKCLPPTTEQNYAELAQELVFNENVLLQTLGF 173
            ..|.|...|.:.||||.|||:.|:|.:.|.:||....|....: |..|..:::..|.|||.:|.|
 Worm    69 QSFSREVTALSCLFLAGKVEDFPKKCKDVCQAAVTHYPEIYSK-YQNLVDDVMGLERVLLHSLKF 132

  Fly   174 DVAIDHPHTHVVRTCQLV-----KACKDLAQTSYFLASNSLHLTSMCLQYRPTVVACFCIYLA-- 231
            |:.:..|:..::....:.     :...|..|.::...::|:: |::|:...|.::|...::||  
 Worm   133 DLHVALPYDALLDYKMMFPDMNREKITDAVQIAWTFINDSIY-TTLCITTEPQMIAIALLHLAFT 196

  Fly   232 -------------CKW----SRWEIPQSTEGKHWFYYVDKTVSLDLLKQLTDEFIAIYEKSPARL 279
                         |.|    |.|  ||.:        |||...|.|      :|.|..::.|...
 Worm   197 VKGYQPVQKNMDPCWWSADVSNW--PQES--------VDKACHLVL------DFYAATKEKPVLE 245

  Fly   280 KSKLNS 285
            |.||.:
 Worm   246 KKKLTT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 49/131 (37%)
CYCLIN <203..>251 CDD:214641 13/66 (20%)
ccnk-1NP_506615.2 CCL1 12..250 CDD:227640 73/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.