DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and cic-1

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_497548.2 Gene:cic-1 / 175357 WormBaseID:WBGene00000506 Length:302 Species:Caenorhabditis elegans


Alignment Length:330 Identity:69/330 - (20%)
Similarity:118/330 - (35%) Gaps:94/330 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FEKDKIWYFSNDQLANSPSRRCGIKGDDELQYRQMTAY------LIQEMGQRLQVSQLC------ 91
            |:|.:||          ..|...:|..:|.:|.::..:      .:...|...|.:..|      
 Worm    16 FDKTEIW----------KQRAEDMKIYNEEEYNRLNIFWANFITAVATEGAHSQANVGCKLRQQV 70

  Fly    92 INTAIVYMHRFYAFHSFTHFHRNSMASASLFLAAKVEEQPRKLEHVIRAANKCLPPT-------- 148
            |.|||:|..|||...||.......:||.:||||.|||      ||...:.:..|..|        
 Worm    71 IATAIIYFKRFYLRQSFRDMCPFLVASTALFLACKVE------EHTTLSVSSFLKNTAIVLPKRW 129

  Fly   149 --TEQNYAELAQELVFNENVLLQTLGFDVAIDHPHTHVVRTCQLVKACKDLAQTSYF-------- 203
              |.:..:.....:..:|.:|::.|...:.:.|....:.   :|::..|...|.|..        
 Worm   130 GVTFETTSTKNGVVYDSEFILVEILDCCLVVHHASRPMF---ELLEDLKQFTQQSTIANQPIKDL 191

  Fly   204 ---------LASNSLHLTSMCLQYRPTVVACFCIYLACKWSRWEIPQSTEGKHWFYYVDKTVSLD 259
                     :|::||. ..:.|.:.|.|:....|.:|.:.    :.:..|.:.|...||..    
 Worm   192 EAIEAQCQKVANDSLR-CDVSLIFPPHVIGLSSIMVAMEL----MGRGEELEAWLVEVDTD---- 247

  Fly   260 LLKQLTDEFIAIY----------EKSPA-RLKSKLNSIKAIAQGASNRTANSKDKPKEDWKITEM 313
             .:::||....||          ||... :|.:||..            .|.:..|::.   .:.
 Worm   248 -FEKVTDCVEQIYKMYTLWKSFDEKEEVKKLMAKLPK------------PNQQPPPQQQ---HQH 296

  Fly   314 MKGYH 318
            .:|||
 Worm   297 QQGYH 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 36/155 (23%)
CYCLIN <203..>251 CDD:214641 10/64 (16%)
cic-1NP_497548.2 CYCLIN 64..>108 CDD:238003 20/49 (41%)
CYCLIN 162..261 CDD:294043 21/111 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.