DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycT and koko

DIOPT Version :9

Sequence 1:NP_001261992.1 Gene:CycT / 39961 FlyBaseID:FBgn0025455 Length:1097 Species:Drosophila melanogaster
Sequence 2:NP_732338.1 Gene:koko / 14462485 FlyBaseID:FBgn0264816 Length:259 Species:Drosophila melanogaster


Alignment Length:235 Identity:57/235 - (24%)
Similarity:100/235 - (42%) Gaps:37/235 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LQYRQM-----TAYLIQEMGQRLQVSQLCINTAIVYMHRFYAFHSFTHFHRNSMASASLFLAAKV 127
            :.||:|     ....|.|...:|::..|....|.:..|||:.....:.:....:|:.||:||.|:
  Fly    25 IDYRKMNKPGVVPMYIFECAAKLKMKPLTAACAAIVFHRFFREVKASDYDEFLIAAGSLYLAGKI 89

  Fly   128 -EEQPRKLEHVIRAANKCL-----PPTTEQNYAELAQELVFNENVLLQTLGFDVAIDHPH---TH 183
             |::..|:..||..|...|     |......|..:...:|..|.::.:||.||:.||..|   .|
  Fly    90 KEDESVKIRDVINVAYCTLNRGNDPVDLNDEYWSMRDAIVQAELLITRTLCFDLNIDLAHKYLLH 154

  Fly   184 VVRTCQ------------LVKACKDLAQTSYFLASNSLHLTSMCLQYRPTVVACFCIYLACKWSR 236
            .::|.|            :.||.....|        ..|.::..|:|:||.||..|:.||.:...
  Fly   155 YMKTLQDWVGTEVWNSVPIAKAAASYLQ--------DFHHSANILKYKPTHVAIGCLSLALQTYG 211

  Fly   237 WEIP---QSTEGKHWFYYVDKTVSLDLLKQLTDEFIAIYE 273
            .::|   :|.|...|:..:.|..:.:...::.:..|.:|:
  Fly   212 IQVPLTDESDESAMWYKPLVKDFTRENQWEIIENVIEVYK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycTNP_001261992.1 Cyclin_N 42..176 CDD:278560 31/118 (26%)
CYCLIN <203..>251 CDD:214641 14/50 (28%)
kokoNP_732338.1 Cyclin_N 6..144 CDD:278560 31/118 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10026
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.