DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Ctrc

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001029047.1 Gene:Ctrc / 76701 MGIID:1923951 Length:268 Species:Mus musculus


Alignment Length:269 Identity:90/269 - (33%)
Similarity:133/269 - (49%) Gaps:20/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVCVLLVGSCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLN-VSFGNWSTWCGGTLISHYWIIT 67
            :|.|....|..|..|   ::...:..||.|....:|:|..|. :....|...|||:||:...::|
Mouse    10 ILACASSCGDPTFPP---NLSARVVGGEDAVPNSWPWQVSLQYLRDDTWRHTCGGSLITTSHVLT 71

  Fly    68 AAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFT 132
            ||||::...:..|.||..|:..|.|||.  :..|...|.||..:....:.|||::|:|...|..:
Mouse    72 AAHCINTNLTYRVGLGKYNLTVEDEEGS--VYAEVDTIYVHEKWNRLLLWNDIAIIKLAEPVELS 134

  Fly   133 DRIRAASLPRR---LNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRM--YW 192
            |.|:.|.:|.:   |.|.:|.|      .:|||| ...:..::.||:....||:.|:.|..  :|
Mouse   135 DTIQVACIPEQDSLLPGDYPCY------VTGWGR-LWTNGPIAEVLQQGLQPIVNHTTCSRLDWW 192

  Fly   193 SGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLI-GSTSFGTSMGCQV-GFPAVFTRISS 255
            ...|.|.|:|.......|.|:|||||||.....:..:.: |..|||:|.||.. ..|.||||:|:
Mouse   193 FIKVRETMVCAGGDGVISACNGDSGGPLNCPVEDGLWQVHGIVSFGSSRGCNTYKKPVVFTRVSA 257

  Fly   256 YLDWILNHI 264
            |:|||...|
Mouse   258 YIDWIKEKI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 84/243 (35%)
Tryp_SPc 27..260 CDD:214473 82/240 (34%)
CtrcNP_001029047.1 Tryp_SPc 29..262 CDD:214473 82/241 (34%)
Tryp_SPc 30..265 CDD:238113 84/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.