DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Prss8

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:289 Identity:92/289 - (31%)
Similarity:138/289 - (47%) Gaps:41/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLLVCVLLVG-------------SCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWST 53
            ::.:..:||:|             ||.||     ::|.||.|..|:.||:|:|..:... ||.. 
Mouse    12 LEAVTILLLLGLLQSGIRADGTEASCGAV-----IQPRITGGGSAKPGQWPWQVSITYD-GNHV- 69

  Fly    54 WCGGTLISHYWIITAAHCM---DGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMAST 115
             |||:|:|:.|:::||||.   ...|:..|.|||..:...|   .:.::...:.||.||:|....
Mouse    70 -CGGSLVSNKWVVSAAHCFPREHSREAYEVKLGAHQLDSYS---NDTVVHTVAQIITHSSYREEG 130

  Fly   116 VVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSP-VLRYVE 179
            ...||:||||.:.|.|:..||...|| ..|..||  ..:....:|||..:.:....:| .|:.:|
Mouse   131 SQGDIALIRLSSPVTFSRYIRPICLP-AANASFP--NGLHCTVTGWGHVAPSVSLQTPRPLQQLE 192

  Fly   180 MPIMPHSLCR-MYWSGAVSEK-------MICMS-TTSGKSTCHGDSGGPLVYKQGNSSYLIGSTS 235
            :|::....|. :|...||.|:       |:|.. ...||..|.|||||||........||.|..|
Mouse   193 VPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVS 257

  Fly   236 FGTSMGCQVGFPAVFTRISSYLDWILNHI 264
            :|.:.|.. ..|.|:|..|:|..||.:|:
Mouse   258 WGDACGAP-NRPGVYTLTSTYASWIHHHV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 83/248 (33%)
Tryp_SPc 27..260 CDD:214473 81/245 (33%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 83/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.