DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Prss22

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:285 Identity:81/285 - (28%)
Similarity:130/285 - (45%) Gaps:45/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVCVLLVGSCTAVPLLTDVEP---------YITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTL 59
            |::.|||..:.........|.|         .|..||.:...|:|:...:   ..|.|..|.|:|
Mouse    76 LILLVLLTSTAPISAATIRVSPDCGKPQQLNRIVGGEDSMDAQWPWIVSI---LKNGSHHCAGSL 137

  Fly    60 ISHYWIITAAHC----MDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVN-D 119
            :::.|::|||||    ||.....:|.|||..:|......|:   |..:.::.|..|......: |
Mouse   138 LTNRWVVTAAHCFKSNMDKPSLFSVLLGAWKLGSPGPRSQK---VGIAWVLPHPRYSWKEGTHAD 199

  Fly   120 ISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIR------AFASGWGRESDASDSVSP-VLRY 177
            |:|:||...:.|::||....||.         .|:|      .:.:|||...|......| .|:.
Mouse   200 IALVRLEHSIQFSERILPICLPD---------SSVRLPPKTDCWIAGWGSIQDGVPLPHPQTLQK 255

  Fly   178 VEMPIMPHSLCR-MYWSG----AVSEKMICMSTTSG-KSTCHGDSGGPLVYKQGNSSYLIGSTSF 236
            :::||:...||: :||.|    |::|.|:|.....| :..|.|||||||:.:..:...|.|..|:
Mouse   256 LKVPIIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISW 320

  Fly   237 GTSMGC-QVGFPAVFTRISSYLDWI 260
            |.  || :...|.|:|.:.::..|:
Mouse   321 GE--GCAERNRPGVYTSLLAHRSWV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 75/253 (30%)
Tryp_SPc 27..260 CDD:214473 74/251 (29%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 75/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.