DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and ctrb.2

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001038747.1 Gene:ctrb.2 / 692313 ZFINID:ZDB-GENE-060519-7 Length:263 Species:Danio rerio


Alignment Length:269 Identity:80/269 - (29%)
Similarity:131/269 - (48%) Gaps:16/269 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVCVLLVGSC-----TAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHY 63
            :|:|:.|:|:.     .|:|.:......|.|||.|....:|:|..|..|.|  ..:|||:||:.:
Zfish     6 ILLCLALIGTAYGCGVPAIPPVITGYARIVNGEEAVPHSWPWQVSLQDSTG--FHFCGGSLINEW 68

  Fly    64 WIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAF 128
            |::||||| :...|..|.||.   .|.|...:....:....:..|.|:...|:.|||.||:|...
Zfish    69 WVVTAAHC-NVRTSHRVILGE---HDRSSNAESIQTMTVGKVFKHPNFNMFTINNDILLIKLATP 129

  Fly   129 VGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWS 193
            ......:....| ...|..||  ..::...||||.....:.....:|:...:|::.:..|:.:|.
Zfish   130 AKINTHVSPVCL-AETNDNFP--GGMKCVTSGWGLTKHNAPDTPALLQQAALPLLTNEDCKRFWG 191

  Fly   194 GAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLD 258
            ..:::.|:| :..||.|:|.||||||||.::.....|:|..|:|:|: |....|.|:.|::....
Zfish   192 NKITDLMVC-AGASGASSCMGDSGGPLVCQKDGVWTLVGIVSWGSSV-CSPSSPGVYARVTKLRA 254

  Fly   259 WILNHIIAH 267
            |:...|.|:
Zfish   255 WVDQTITAN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 72/235 (31%)
Tryp_SPc 27..260 CDD:214473 71/232 (31%)
ctrb.2NP_001038747.1 Tryp_SPc 33..256 CDD:214473 71/233 (30%)
Tryp_SPc 34..259 CDD:238113 72/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.