DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Ctrb1

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_079859.2 Gene:Ctrb1 / 66473 MGIID:88559 Length:263 Species:Mus musculus


Alignment Length:266 Identity:84/266 - (31%)
Similarity:137/266 - (51%) Gaps:24/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVCVLLVGS---C---TAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISH 62
            |:.|..|||:   |   ...|:||.:. .|.|||.|..|.:|:|..|....|  ..:|||:|||.
Mouse     6 LVSCFALVGATFGCGVPAIQPVLTGLS-RIVNGEDAIPGSWPWQVSLQDRTG--FHFCGGSLISE 67

  Fly    63 YWIITAAHCMDGAESVTVYLGAINIGDESEEG--QERIMVEK-SGIIVHSNYMASTVVNDISLIR 124
            .|::|||||  |.::..|.     :..|.::|  :|.:.|.| :.:..:..:.:.||.|||:|::
Mouse    68 NWVVTAAHC--GVKTTDVV-----VAGEFDQGSDEENVQVLKIAQVFKNPKFNSFTVRNDITLLK 125

  Fly   125 LPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCR 189
            |.....|::.:.|..|| .::..||.  ......:|||:....:......|:...:||:..:.|:
Mouse   126 LATPAQFSETVSAVCLP-TVDDDFPA--GTLCATTGWGKTKYNALKTPDKLQQAALPIVSEAKCK 187

  Fly   190 MYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRIS 254
            ..|...:::.||| :..||.|:|.||||||||.::.....|.|..|:|:.. |....|||:.|::
Mouse   188 ESWGSKITDVMIC-AGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWGSGF-CSTSTPAVYARVT 250

  Fly   255 SYLDWI 260
            :.:.|:
Mouse   251 ALMPWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 75/237 (32%)
Tryp_SPc 27..260 CDD:214473 74/235 (31%)
Ctrb1NP_079859.2 Tryp_SPc 33..256 CDD:214473 74/236 (31%)
Tryp_SPc 34..259 CDD:238113 75/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.