DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG18754

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:244 Identity:63/244 - (25%)
Similarity:101/244 - (41%) Gaps:32/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHCMDGA--ESVTVYLGAINIGDE--- 90
            |.||:.::|:...|...         ..|....:::|||||:.|.  ....:.|.::.:|:.   
  Fly   110 ENAELNEYPWMVLLLYE---------NRLSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTD 165

  Fly    91 ---SEEGQERIMVEKSGIIVHSNYMAS--TVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPT 150
               ||.....:.||.....||..:.:|  |..|||:|:||...|.:|.:|:...|   |:.:|| 
  Fly   166 CITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICL---LDAEFP- 226

  Fly   151 YESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEKMICMSTTSGKSTCHGD 215
            .:.:....|||    |.:.|...::........|......|.|.. |...:|........||.|.
  Fly   227 LQDLNLQISGW----DPTKSSQTLITSTVKERNPADCLNRYPSFR-SASQVCAGGQRKGDTCAGI 286

  Fly   216 SGGPLVYKQGNS----SYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260
            ||.|::...|:.    .:|.|..|:|.......|.|.|:|:|..:.:||
  Fly   287 SGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 63/244 (26%)
Tryp_SPc 27..260 CDD:214473 61/242 (25%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 63/244 (26%)
Tryp_SPc 108..335 CDD:214473 61/242 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.