DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG34409

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:277 Identity:81/277 - (29%)
Similarity:124/277 - (44%) Gaps:50/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DVEPYITNGEPAEVGQFPYQAGL---NVSFGNWSTWCGGTLISHYWIITAAHCMDGAESVTVYLG 83
            :||..:..|:.|..||||:...:   |.|....|..|.|:|||...|:|||||:....| .:.|.
  Fly   245 NVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVS-DLELS 308

  Fly    84 AINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRL--------PAFVGFTDRIRAASL 140
            .:.:|  |::|.....:|:  :|||.||......|||:|:|:        |..:.|...|   :|
  Fly   309 HVRLG--SQDGATPFAIEQ--VIVHPNYDQPKYANDIALLRINSTNGTFTPICLPFNGPI---TL 366

  Fly   141 PRRLNGQFPTYESIRAFASGWGRES-------DASDSVSPVLRYVEMPIMPHSLCRMYWSG---- 194
            ..||.||.       ..|:||...|       |.|:|.:.| |::.:||:..:.|.:.::.    
  Fly   367 GNRLIGQI-------GVAAGWSIGSTENNSSMDPSNSTAGV-RFIRLPIVNTTSCAIAYASLSEN 423

  Fly   195 -----AVSEKMICMSTTSGKSTCHGDSGGPL-------VYKQGNSSYLIGSTSFGTSMGCQVGFP 247
                 .::...:|.........|.||||||.       |:.......:||..:||.::......|
  Fly   424 FQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLCGVTTIP 488

  Fly   248 AVFTRISSYLDWILNHI 264
            .|:|.:||:.||||..|
  Fly   489 GVYTLVSSFSDWILRSI 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 78/269 (29%)
Tryp_SPc 27..260 CDD:214473 75/266 (28%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 75/267 (28%)
Tryp_SPc 252..501 CDD:238113 75/264 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.