DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Klk11

DIOPT Version :10

Sequence 1:NP_648995.3 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:49 Identity:16/49 - (32%)
Similarity:22/49 - (44%) Gaps:15/49 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IQILLFALVLIFVEANAATQGKNTTIPALIVFGDSIMDTGNNNNLPTLL 51
            |:::|.|||           |..|.  |.:||  .|..||:.:..|.||
Mouse   237 IRLVLSALV-----------GMATL--AFLVF--DIRSTGSEHKKPILL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_648995.3 Tryp_SPc 27..263 CDD:238113 9/25 (36%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 14/46 (30%)

Return to query results.
Submit another query.