DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and PRSS1

DIOPT Version :10

Sequence 1:NP_648995.3 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_002760.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:247 Species:Homo sapiens


Alignment Length:41 Identity:11/41 - (26%)
Similarity:19/41 - (46%) Gaps:4/41 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 ISYLCNSLNPFTCSNSSAYIFWDSYHPSERAYQVIVDNLLD 342
            |:.:|.|....:|.|.|....:.    ||..:::.|..|:|
Human    74 INRVCTSSKKMSCPNDSDLFCFQ----SETKFRMTVCQLID 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_648995.3 Tryp_SPc 27..263 CDD:238113
PRSS1NP_002760.1 Tryp_SPc 23..239 CDD:214473 11/41 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.