DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and zgc:112285

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001020685.1 Gene:zgc:112285 / 561476 ZFINID:ZDB-GENE-050913-132 Length:316 Species:Danio rerio


Alignment Length:256 Identity:81/256 - (31%)
Similarity:124/256 - (48%) Gaps:31/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ITNGEPAEVGQFPYQAGLNV---SFGNWSTWCGGTLISHYWIITAAHCM-----DGAESVTVYLG 83
            |.:|..|....:|:|..|.|   ...::...||||||...|::|||||.     :.|.|..:.||
Zfish    59 IVSGNEARPHSWPWQVSLQVRPRGSKHYVHVCGGTLIHKNWVLTAAHCFQKGKAEDASSWRIVLG 123

  Fly    84 AINIGDESEEGQERIMVEKSGIIVHSNYMASTVVN-DISLIRLPAFVGFTDRIRAASLPRR---L 144
            ...: ..||..:....|::.....|..|.|.:.:: ||:|::....:..::.||.|.|||:   |
Zfish   124 KHQL-KRSETAERFFPVKRIYRHEHFRYPAHSELDYDIALVKAATDIQPSNFIRYACLPRKQINL 187

  Fly   145 N-GQFPTYESIRAFASGWGRESDASDSVS--PVLRYVEMPIMPHSLCRM--YWSGAVSEKMIC-- 202
            | |.:       .:.:|||......::||  ..|....:||:.:..||.  :|...|.:.|||  
Zfish   188 NPGHY-------CWVTGWGDTRGGKENVSLAEALNQARLPIIDYKTCRQKKFWGDRVRDSMICAG 245

  Fly   203 -MSTTSGKSTCHGDSGGPLVYKQGNSSYLI-GSTSFGTSMGCQV-GFPAVFTRISSYLDWI 260
             ..|....:.|.|||||||:.:.|...:.: |..||| .:||.| ..|:||||.::|:.||
Zfish   246 FRDTEGTPAACQGDSGGPLLCQVGRDRWEVHGIVSFG-PIGCTVENKPSVFTRTAAYIPWI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 81/256 (32%)
Tryp_SPc 27..260 CDD:214473 79/254 (31%)
zgc:112285NP_001020685.1 Tryp_SPc 58..305 CDD:214473 79/254 (31%)
Tryp_SPc 59..308 CDD:238113 81/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.