DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and cela1.1

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:281 Identity:97/281 - (34%)
Similarity:146/281 - (51%) Gaps:28/281 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVCVLLVGSCTAVPLLTD--VEPYITNGEPAEVGQFPYQAGLNV-SFGNWSTWCGGTLISHYWI 65
            ||:.||.....|....|.|  :|..:..||.|:...:|:|..|.. |.|.:..:||||||...|:
Zfish     5 LLLSVLAAIGLTEPRYLEDLAIEERVIGGEIAKPHSWPWQISLQYQSGGRYHHYCGGTLIRPGWV 69

  Fly    66 ITAAHCMDGAESVTVYLGAINIGDE---SEEGQERIMVEKSGIIVHSNYMASTVV--NDISLIRL 125
            :.||||:|     |..:.::.:||.   :.||.|:.:..| |:.:|.|:..:.|.  |||:|::|
Zfish    70 MVAAHCVD-----TSRIWSVALGDHDTTTHEGPEQYISVK-GVFIHPNWNPNIVANGNDIALLQL 128

  Fly   126 PAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRM 190
            ......:..::.|:||.  .|:...| ....:.:|||| :....|:|..|:...||::.|..|..
Zfish   129 SINATLSSYVQVATLPS--YGEILPY-GHTCYITGWGR-TQTGGSLSAQLKQAYMPVVDHETCSQ 189

  Fly   191 --YWSGAVSEKMICMSTTSGKSTCHGDSGGPL--VYKQGNSSYLI-GSTSFGTSMGCQV-GFPAV 249
              :|...|.::|||...|:..|.||||||.||  ::   |..|:: |.|||..|.||.. ..|.|
Zfish   190 SDWWGSTVKDRMICAGGTTSMSACHGDSGSPLNCLF---NGEYVVHGVTSFVASSGCNTYKKPTV 251

  Fly   250 FTRISSYLDWILNHIIAHNKE 270
            |||:|.::.| ||||:..|.|
Zfish   252 FTRVSYHVSW-LNHIMYENGE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 84/247 (34%)
Tryp_SPc 27..260 CDD:214473 82/244 (34%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 82/244 (34%)
Tryp_SPc 30..265 CDD:238113 85/248 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.