DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and ctrb.3

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:281 Identity:90/281 - (32%)
Similarity:134/281 - (47%) Gaps:37/281 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVCVLLVGSC-----TAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHY 63
            ||.||....:.     .|:|.:......|.|||.|....:|:|..|....|  ..:|||:||:.:
Zfish     6 LLSCVAFFSAAYGCGVPAIPPVVSGYARIVNGEEAVPHSWPWQVSLQDFTG--FHFCGGSLINEF 68

  Fly    64 WIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEK-SGIIVHSNYMASTVVNDISLIRLPA 127
            |::||||| ....|..|.||..|.|..:.  ||.|...| |.:..|..|.::|:.|||:|::|.|
Zfish    69 WVVTAAHC-SVRTSHRVILGEHNKGKSNT--QEDIQTMKVSKVFTHPQYNSNTIENDIALVKLTA 130

  Fly   128 FVGFTDRIRAASLPRRLNGQFPTY---ESIRAFA-------SGWGRESDASDSVSPVLRYVEMPI 182
                         |..||......   |:...||       ||||.....:......|:.|.:|:
Zfish   131 -------------PASLNAHVSPVCLAEASDNFASGMTCVTSGWGVTRYNALFTPDELQQVALPL 182

  Fly   183 MPHSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFP 247
            :.:..|:.:|...:.:.||| :..:|.|:|.||||||||.::.|...|:|..|:|:|. |....|
Zfish   183 LSNEDCKNHWGSNIRDTMIC-AGAAGASSCMGDSGGPLVCQKDNIWTLVGIVSWGSSR-CDPTMP 245

  Fly   248 AVFTRISSYLDWILNHIIAHN 268
            .|:.|::...||: :.|:|.|
Zfish   246 GVYGRVTELRDWV-DQILASN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 81/246 (33%)
Tryp_SPc 27..260 CDD:214473 80/243 (33%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 80/244 (33%)
Tryp_SPc 34..261 CDD:238113 81/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.