DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Tpsab1

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:290 Identity:88/290 - (30%)
Similarity:138/290 - (47%) Gaps:47/290 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMKLLVCVL-LVGSCT-AVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHY 63
            |:|||:..| |:.|.. |.|.|......|..|:.|...::|:|..|.|:...|..:|||:||...
  Rat    38 MLKLLLLTLPLLSSLVHAAPSLAMPREGIVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQ 102

  Fly    64 WIITAAHCMDGAESVTVYLGAINIG-DESEEGQERIMVEK------------SGIIVHSNYMAST 115
            |::|||||               :| ::::..:.|:.:.|            |.||.|.::..:.
  Rat   103 WVLTAAHC---------------VGPNKADPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQ 152

  Fly   116 VVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGR-ESDASDSVSPVLRYVE 179
            ...||:|::|...|..|..:...||| ..:..||:  ....:.:|||. .:|.|......|..|:
  Rat   153 DGADIALLKLTNPVNITSNVHTVSLP-PASETFPS--GTLCWVTGWGNINNDVSLPPPFPLEEVQ 214

  Fly   180 MPIMPHSLCRM-YWSG--------AVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTS 235
            :||:.:.||.: |..|        .|.:.|:| :...|..:|.||||||||.|..::....|..|
  Rat   215 VPIVENRLCDLKYHKGLNTGDNVHIVRDDMLC-AGNEGHDSCQGDSGGPLVCKVEDTWLQAGVVS 278

  Fly   236 FGTSMGC-QVGFPAVFTRISSYLDWILNHI 264
            :|.  || |...|.::||::.|||||..::
  Rat   279 WGE--GCAQPNRPGIYTRVTYYLDWIYRYV 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 78/259 (30%)
Tryp_SPc 27..260 CDD:214473 76/256 (30%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 76/256 (30%)
Tryp_SPc 66..302 CDD:238113 76/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.